PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400001575
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 377aa    MW: 41314.4 Da    PI: 5.9634
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400001575genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.11.7e-32214269156
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                           k+r++W+peLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  PGSC0003DMP400001575 214 KQRRCWSPELHRRFLHALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 269
                           79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.542211271IPR017930Myb domain
SuperFamilySSF466891.63E-18212272IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.3E-29212272IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-27214269IPR006447Myb domain, plants
PfamPF002491.5E-7216267IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MERCQQYIDA LEQERTKIQV FSRELPLCLE LVTQAIETYK QQLSGTTTEY NLNAQSTECS  60
DDEHTSSDVP VLEEFIPLKS TFSHEDEDED EEEDDEENQS HKSKSLIINN NNTSNSTSSK  120
DTKNKKSDWL RSVQLWNQTS DPTPKEELTP KKVSVVEVKK NGSGGAFHPF KKEKNAVATV  180
ETTPISGVVL AATDSSTVEN GGGNKKEDKD GQRKQRRCWS PELHRRFLHA LQQLGGSHVA  240
TPKQIRELMK VDGLTNDEVK SHLQKYRLHT RRPSPSSIHN NNQQPTQFVV VGGIWVPPPE  300
YAAMAAAAPA ASGEASGVAN SNGIYAPIAT HPKGPLHDHA SEERDAPPSH SDCGGVHSNS  360
PATSSSTHTT TASPAY*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755171e-133HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006362570.20.0PREDICTED: uncharacterized protein LOC102595401
TrEMBLM0ZJR20.0M0ZJR2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000021620.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.15e-83G2-like family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]